PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.0279H
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 551aa    MW: 60727.1 Da    PI: 5.8206
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.0279HgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.6e-183784148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed  lvd+v+++G g+W+++ ++ g+ R++k+c++rw ++l
      Araip.0279H 37 KGPWTTSEDAMLVDYVNKHGEGNWNAVQKYSGLLRCGKSCRLRWANHL 84
                     79******************************99**********9986 PP

2Myb_DNA-binding513.3e-1690133146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ l++++++++G++ W++ a++++ gRt++++k++w++
      Araip.0279H  90 KGAFTAEEERLIAELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 133
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3973284IPR017930Myb domain
SuperFamilySSF466896.74E-3036131IPR009057Homeodomain-like
SMARTSM007171.2E-143686IPR001005SANT/Myb domain
PfamPF002491.4E-153784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-233891IPR009057Homeodomain-like
CDDcd001672.38E-113984No hitNo description
PROSITE profilePS5129425.06785139IPR017930Myb domain
SMARTSM007172.2E-1689137IPR001005SANT/Myb domain
PfamPF002492.9E-1590133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2592138IPR009057Homeodomain-like
CDDcd001678.20E-1292133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MRRLNNQNED EVLANDQTGL QLNDESKGGH AGVVLKKGPW TTSEDAMLVD YVNKHGEGNW  60
NAVQKYSGLL RCGKSCRLRW ANHLRPNLKK GAFTAEEERL IAELHAKMGN KWARMAAHLP  120
GRTDNEIKNY WNTRIKRRQR AGLPLYPPEL CVQAVQENQH GRSSGGIDGG NNMHHDFVHK  180
NYEIHSAIFD SWNGSQGILP YPPELPDISA YTGMLKGFDS SKYCKFEQIT SPNHKRLRES  240
TTPFIGSGGM NTNWFYPFDQ IQDNTPDKIA QSFGMQSPFD LGPSPHSSIC YSHSLSNGNS  300
STSKPAYEAV KFELPSLQYP ETDVGSWSTS PPPPLLESVD DFIQSPLPVS ALESDCSSPQ  360
NSGLLDALLY QARTLSNSKN HYSDKSSNSS TATPCDRALS STLNKYETDW EDYTDTISPF  420
GATSILNECT VASASANSLD EHPTVRSFND NIVKTENVDQ VWSPNSENQG MSAIKITRPD  480
VLLASDWLQQ GSGHDMRQGS MADDIPALRE DDLATDSKHT SSGTSLLSQV CGFGSCGRSV  540
MPAFCQGSDR G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30351385107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016171706.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_016171708.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A151RGG10.0A0A151RGG1_CAJCA; Transcription factor GAMYB
STRINGGLYMA13G25716.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-121myb domain protein 33